Class b: All beta proteins [48724] (180 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.1: Diphtheria toxin, C-terminal domain [49380] (2 families) automatically mapped to Pfam PF01324 |
Family b.2.1.1: Diphtheria toxin, C-terminal domain [49381] (1 protein) |
Protein Diphtheria toxin, C-terminal domain [49382] (1 species) |
Species Corynebacterium diphtheriae [TaxId:1717] [49383] (7 PDB entries) |
Domain d1toxa1: 1tox A:381-535 [22383] Other proteins in same PDB: d1toxa2, d1toxa3, d1toxb2, d1toxb3 complexed with nad |
PDB Entry: 1tox (more details), 2.3 Å
SCOPe Domain Sequences for d1toxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1toxa1 b.2.1.1 (A:381-535) Diphtheria toxin, C-terminal domain {Corynebacterium diphtheriae [TaxId: 1717]} spghktqpflhdgyavswntvedsiirtgfqgesghdikitaentplpiagvllptipgk ldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvgngvhanlhvafhrsssekih sneissdsigvlgyqktvdhtkvnsklslffeiks
Timeline for d1toxa1: