![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.1: Diphtheria toxin, C-terminal domain [49380] (2 families) ![]() automatically mapped to Pfam PF01324 |
![]() | Family b.2.1.1: Diphtheria toxin, C-terminal domain [49381] (1 protein) |
![]() | Protein Diphtheria toxin, C-terminal domain [49382] (1 species) |
![]() | Species Corynebacterium diphtheriae [TaxId:1717] [49383] (7 PDB entries) |
![]() | Domain d1mdtb1: 1mdt B:381-535 [22382] Other proteins in same PDB: d1mdta2, d1mdta3, d1mdtb2, d1mdtb3 complexed with apu |
PDB Entry: 1mdt (more details), 2.3 Å
SCOPe Domain Sequences for d1mdtb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mdtb1 b.2.1.1 (B:381-535) Diphtheria toxin, C-terminal domain {Corynebacterium diphtheriae [TaxId: 1717]} spghktqpflhdgyavswntvedsiirtgfqgesghdikitaentplpiagvllptipgk ldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvgngvhanlhvafhrsssekih sneissdsigvlgyqktvdhtkvnsklslffeiks
Timeline for d1mdtb1: