Lineage for d1mdtb1 (1mdt B:381-535)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1771693Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1771694Superfamily b.2.1: Diphtheria toxin, C-terminal domain [49380] (2 families) (S)
    automatically mapped to Pfam PF01324
  5. 1771695Family b.2.1.1: Diphtheria toxin, C-terminal domain [49381] (1 protein)
  6. 1771696Protein Diphtheria toxin, C-terminal domain [49382] (1 species)
  7. 1771697Species Corynebacterium diphtheriae [TaxId:1717] [49383] (7 PDB entries)
  8. 1771703Domain d1mdtb1: 1mdt B:381-535 [22382]
    Other proteins in same PDB: d1mdta2, d1mdta3, d1mdtb2, d1mdtb3
    complexed with apu

Details for d1mdtb1

PDB Entry: 1mdt (more details), 2.3 Å

PDB Description: the refined structure of monomeric diphtheria toxin at 2.3 angstroms resolution
PDB Compounds: (B:) diphtheria toxin

SCOPe Domain Sequences for d1mdtb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mdtb1 b.2.1.1 (B:381-535) Diphtheria toxin, C-terminal domain {Corynebacterium diphtheriae [TaxId: 1717]}
spghktqpflhdgyavswntvedsiirtgfqgesghdikitaentplpiagvllptipgk
ldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvgngvhanlhvafhrsssekih
sneissdsigvlgyqktvdhtkvnsklslffeiks

SCOPe Domain Coordinates for d1mdtb1:

Click to download the PDB-style file with coordinates for d1mdtb1.
(The format of our PDB-style files is described here.)

Timeline for d1mdtb1: