Lineage for d1mdtb1 (1mdt B:381-535)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 55312Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies)
  4. 55313Superfamily b.2.1: Diphtheria toxin, C-terminal domain [49380] (1 family) (S)
  5. 55314Family b.2.1.1: Diphtheria toxin, C-terminal domain [49381] (1 protein)
  6. 55315Protein Diphtheria toxin, C-terminal domain [49382] (1 species)
  7. 55316Species Corynebacterium diphtheriae [TaxId:1717] [49383] (6 PDB entries)
  8. 55322Domain d1mdtb1: 1mdt B:381-535 [22382]
    Other proteins in same PDB: d1mdta2, d1mdta3, d1mdtb2, d1mdtb3

Details for d1mdtb1

PDB Entry: 1mdt (more details), 2.3 Å

PDB Description: the refined structure of monomeric diphtheria toxin at 2.3 angstroms resolution

SCOP Domain Sequences for d1mdtb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mdtb1 b.2.1.1 (B:381-535) Diphtheria toxin, C-terminal domain {Corynebacterium diphtheriae}
spghktqpflhdgyavswntvedsiirtgfqgesghdikitaentplpiagvllptipgk
ldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvgngvhanlhvafhrsssekih
sneissdsigvlgyqktvdhtkvnsklslffeiks

SCOP Domain Coordinates for d1mdtb1:

Click to download the PDB-style file with coordinates for d1mdtb1.
(The format of our PDB-style files is described here.)

Timeline for d1mdtb1: