Lineage for d1mdta1 (1mdt A:381-535)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2376993Superfamily b.2.1: Diphtheria toxin, C-terminal domain [49380] (2 families) (S)
    automatically mapped to Pfam PF01324
  5. 2376994Family b.2.1.1: Diphtheria toxin, C-terminal domain [49381] (1 protein)
  6. 2376995Protein Diphtheria toxin, C-terminal domain [49382] (1 species)
  7. 2376996Species Corynebacterium diphtheriae [TaxId:1717] [49383] (7 PDB entries)
  8. 2377000Domain d1mdta1: 1mdt A:381-535 [22381]
    Other proteins in same PDB: d1mdta2, d1mdta3, d1mdtb2, d1mdtb3
    complexed with apu

Details for d1mdta1

PDB Entry: 1mdt (more details), 2.3 Å

PDB Description: the refined structure of monomeric diphtheria toxin at 2.3 angstroms resolution
PDB Compounds: (A:) diphtheria toxin

SCOPe Domain Sequences for d1mdta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mdta1 b.2.1.1 (A:381-535) Diphtheria toxin, C-terminal domain {Corynebacterium diphtheriae [TaxId: 1717]}
spghktqpflhdgyavswntvedsiirtgfqgesghdikitaentplpiagvllptipgk
ldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvgngvhanlhvafhrsssekih
sneissdsigvlgyqktvdhtkvnsklslffeiks

SCOPe Domain Coordinates for d1mdta1:

Click to download the PDB-style file with coordinates for d1mdta1.
(The format of our PDB-style files is described here.)

Timeline for d1mdta1: