SCOPe 2.08: Domain d4jgab2: 4jga B:267-428

Lineage for d4jgab2 (4jga B:267-428)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (83 species)
   not a true protein

7. Species Rickettsia rickettsii [TaxId:392021] [226679] (1 PDB entry)

8. Domain d4jgab2: 4jga B:267-428 [223809]
   automated match to d1ox0a2
   complexed with edo, k, na

Details for d4jgab2

PDB Entry: 4jga, 2.1 Å

PDB Description: X-ray crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase 2 from Rickettsia rickettsii

PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase 2

SCOPe Domain Sequences for d4jgab2:

Sequence; same for both SEQRES and ATOM records:

>d4jgab2 c.95.1.0 (B:267-428) automated matches {Rickettsia rickettsii [TaxId: 392021]}
kvygevigygstgdayhmtaphpegrgayramrdamldatitpdmidyinahgtsttlgd
gielaavqklfleanpkvlmsstkssighllgaagsvefifsalairdqiapptlnldtp
mdevnidlvalkakktkidyvlsnsfgfggtnaslviksilv

Timeline for d4jgab2:

• d4jgab2 first appeared in SCOPe 2.03
  
• d4jgab2 appears in SCOPe 2.07