![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies) |
![]() | Superfamily b.2.1: Diphtheria toxin, C-terminal domain [49380] (1 family) ![]() |
![]() | Family b.2.1.1: Diphtheria toxin, C-terminal domain [49381] (1 protein) |
![]() | Protein Diphtheria toxin, C-terminal domain [49382] (1 species) |
![]() | Species Corynebacterium diphtheriae [TaxId:1717] [49383] (6 PDB entries) |
![]() | Domain d1sgk_1: 1sgk 381-535 [22380] Other proteins in same PDB: d1sgk_2, d1sgk_3 |
PDB Entry: 1sgk (more details), 2.3 Å
SCOP Domain Sequences for d1sgk_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sgk_1 b.2.1.1 (381-535) Diphtheria toxin, C-terminal domain {Corynebacterium diphtheriae} spghktqpflhdgyavswntvedsiirtgfqgesghdikitaentplpiagvllptipgk ldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvgngvhanlhvafhrsssekih sneissdsigvlgyqktvdhtkvnsklslffeiks
Timeline for d1sgk_1: