Lineage for d1ddt_1 (1ddt 381-535)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (7 superfamilies) Superfamily b.2.1: Diphtheria toxin, C-terminal domain [49380] (1 family) 
Family b.2.1.1: Diphtheria toxin, C-terminal domain [49381] (1 protein) Protein Diphtheria toxin, C-terminal domain [49382] (1 species) Species Corynebacterium diphtheriae [TaxId:1717] [49383] (6 PDB entries) 
Domain d1ddt_1: 1ddt 381-535 [22379]
Other proteins in same PDB: d1ddt_2, d1ddt_3
Details for d1ddt_1
PDB Entry: 1ddt (more details), 2 Å
PDB Description: the refined structure of dimeric diphtheria toxin at 2.0 angstroms resolution
SCOP Domain Sequences for d1ddt_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ddt_1 b.2.1.1 (381-535) Diphtheria toxin, C-terminal domain {Corynebacterium diphtheriae}
spghktqpflhdgyavswntvedsiirtgfqgesghdikitaentplpiagvllptipgk
ldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvgngvhanlhvafhrsssekih
sneissdsigvlgyqktvdhtkvnsklslffeiks
SCOP Domain Coordinates for d1ddt_1:
Click to download the PDB-style file with coordinates for d1ddt_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ddt_1:
- d1ddt_1 appears in SCOP 1.57
- d1ddt_1 appears in the current release, SCOPe 2.08, called d1ddta1
View in 3D
