SCOPe 2.08: Domain d4jfhd2: 4jfh D:111-200

Lineage for d4jfhd2 (4jfh D:111-200)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4jfhd2: 4jfh D:111-200 [223782]
   Other proteins in same PDB: d4jfhd1, d4jfhe1
   automated match to d1qrnd2
   complexed with edo, gol, so4

Details for d4jfhd2

PDB Entry: 4jfh, 2.4 Å

PDB Description: High Affinity alpha24-beta17 T Cell Receptor for A2 HLA-Melanoma peptide complex

PDB Compounds: (D:) alpha24 TCR allele

SCOPe Domain Sequences for d4jfhd2:

Sequence; same for both SEQRES and ATOM records:

>d4jfhd2 b.1.1.2 (D:111-200) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpsp

Timeline for d4jfhd2:

• d4jfhd2 first appeared in SCOPe 2.03
  
• d4jfhd2 appears in SCOPe 2.07