SCOPe 2.06: Domain d1f0la1: 1f0l A:381-535

Lineage for d1f0la1 (1f0l A:381-535)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.1: Diphtheria toxin, C-terminal domain [49380] (2 families)
   automatically mapped to Pfam PF01324

5. Family b.2.1.1: Diphtheria toxin, C-terminal domain [49381] (1 protein)

6. Protein Diphtheria toxin, C-terminal domain [49382] (1 species)

7. Species Corynebacterium diphtheriae [TaxId:1717] [49383] (7 PDB entries)

8. Domain d1f0la1: 1f0l A:381-535 [22377]
   Other proteins in same PDB: d1f0la2, d1f0la3, d1f0lb2, d1f0lb3
   complexed with apu, cl

Details for d1f0la1

PDB Entry: 1f0l, 1.55 Å

PDB Description: 1.55 angstrom crystal structure of wild type diphtheria toxin

PDB Compounds: (A:) diphtheria toxin

SCOPe Domain Sequences for d1f0la1:

Sequence; same for both SEQRES and ATOM records:

>d1f0la1 b.2.1.1 (A:381-535) Diphtheria toxin, C-terminal domain {Corynebacterium diphtheriae [TaxId: 1717]}
spghktqpflhdgyavswntvedsiirtgfqgesghdikitaentplpiagvllptipgk
ldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvgngvhanlhvafhrsssekih
sneissdsigvlgyqktvdhtkvnsklslffeiks

Timeline for d1f0la1:

• d1f0la1 first appeared (with stable ids) in SCOP 1.55
  
• d1f0la1 appears in SCOPe 2.05
  
• d1f0la1 appears in SCOPe 2.07
  
• d1f0la1 appears in the current release, SCOPe 2.08