SCOPe 2.08: Domain d4jdpb1: 4jdp B:1-263

Lineage for d4jdpb1 (4jdp B:1-263)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (55 species)
   not a true protein

7. Species Archaeoglobus fulgidus [TaxId:2234] [189636] (2 PDB entries)

8. Domain d4jdpb1: 4jdp B:1-263 [223753]
   Other proteins in same PDB: d4jdpb2
   automated match to d3qgmc_
   complexed with cl, mg

Details for d4jdpb1

PDB Entry: 4jdp, 1.76 Å

PDB Description: Crystal structure of probable p-nitrophenyl phosphatase (pho2) (target EFI-501307) from Archaeoglobus fulgidus DSM 4304 with Magnesium bound

PDB Compounds: (B:) p-nitrophenyl phosphatase (Pho2)

SCOPe Domain Sequences for d4jdpb1:

Sequence; same for both SEQRES and ATOM records:

>d4jdpb1 c.108.1.0 (B:1-263) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
mmpdkkgyiididgvigksvtpipegvegvkklkelgkkiifvsnnstrsrrillerlrs
fglevgedeilvatyatarfiarekpnakvfttgeeglieelrlagleivdydeaeylvv
gsnrkinfelmtkalraclrgiryiatnpdrifpaedgpipgtgmiigalywmtgrepdv
vvgkpsevimrealdilgldakdvavvgdqidvdvaagkaigaetvlvltgvttrenldq
mierhglkpdyvfnslkdmveal

Timeline for d4jdpb1:

• d4jdpb1 first appeared in SCOPe 2.03, called d4jdpb_
  
• d4jdpb1 appears in SCOPe 2.07