Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.0: automated matches [191344] (1 protein) not a true family |
Protein automated matches [190239] (26 species) not a true protein |
Species Bacillus anthracis [TaxId:198094] [226573] (4 PDB entries) |
Domain d4jd1a1: 4jd1 A:1-139 [223743] Other proteins in same PDB: d4jd1a2, d4jd1b2, d4jd1b3 automated match to d1npbc_ complexed with fcn, pge, zn |
PDB Entry: 4jd1 (more details), 1.7 Å
SCOPe Domain Sequences for d4jd1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jd1a1 d.32.1.0 (A:1-139) automated matches {Bacillus anthracis [TaxId: 198094]} mlqginhicfsvsnleksiefyqkilqakllvkgrklayfdlnglwialnveediprnei kqsythmaftvtnealdhlkevliqndvnilpgrerderdqrslyftdpdghkfefhtgt lqnrleyykedkkhmtfyi
Timeline for d4jd1a1: