SCOPe 2.03: Domain d4jcob2: 4jco B:163-330

Lineage for d4jcob2 (4jco B:163-330)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein automated matches [226882] (7 species)
   not a true protein

7. Species Haloarcula marismortui [TaxId:2238] [225148] (4 PDB entries)

8. Domain d4jcob2: 4jco B:163-330 [223698]
   Other proteins in same PDB: d4jcoa1, d4jcob1, d4jcoc1, d4jcod1
   automated match to d1d3aa2
   complexed with cl, na

Details for d4jcob2

PDB Entry: 4jco, 1.7 Å

PDB Description: 1.7 a resolution structure of wild type malate dehydrogenase from haloarcula marismortui

PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d4jcob2:

Sequence; same for both SEQRES and ATOM records:

>d4jcob2 d.162.1.1 (B:163-330) automated matches {Haloarcula marismortui [TaxId: 2238]}
fggrldsarfryvlseefdapvqnvegtilgehgdaqvpvfskvrvdgtdpefsgdekeq
llgdlqesamdvierkgatewgpargvahmveailhdtgevlpasvklegefghedtafg
vpvrlgsngveeivewdlddyeqdlmadaaeklsdqydkis

Timeline for d4jcob2:

• d4jcob2 is new in SCOPe 2.03-stable
  
• d4jcob2 appears in SCOPe 2.04
  
• d4jcob2 appears in the current release, SCOPe 2.08