SCOPe 2.03: Domain d4jcob1: 4jco B:22-162

Lineage for d4jcob1 (4jco B:22-162)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein automated matches [226881] (5 species)
   not a true protein

7. Species Haloarcula marismortui [TaxId:2238] [225147] (4 PDB entries)

8. Domain d4jcob1: 4jco B:22-162 [223697]
   Other proteins in same PDB: d4jcoa2, d4jcob2, d4jcoc2, d4jcod2
   automated match to d1o6za1
   complexed with cl, na

Details for d4jcob1

PDB Entry: 4jco, 1.7 Å

PDB Description: 1.7 a resolution structure of wild type malate dehydrogenase from haloarcula marismortui

PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d4jcob1:

Sequence; same for both SEQRES and ATOM records:

>d4jcob1 c.2.1.5 (B:22-162) automated matches {Haloarcula marismortui [TaxId: 2238]}
tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
rqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyislttsn
pvdllnrhlyeagdrsreqvig

Timeline for d4jcob1:

• d4jcob1 is new in SCOPe 2.03-stable
  
• d4jcob1 appears in SCOPe 2.04
  
• d4jcob1 appears in the current release, SCOPe 2.08