Lineage for d4jcob1 (4jco B:22-162)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844315Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2844864Protein automated matches [226881] (8 species)
    not a true protein
  7. 2844865Species Haloarcula marismortui [TaxId:2238] [225147] (4 PDB entries)
  8. 2844867Domain d4jcob1: 4jco B:22-162 [223697]
    Other proteins in same PDB: d4jcoa2, d4jcob2, d4jcoc2, d4jcod2
    automated match to d1o6za1
    complexed with cl, na

Details for d4jcob1

PDB Entry: 4jco (more details), 1.7 Å

PDB Description: 1.7 a resolution structure of wild type malate dehydrogenase from haloarcula marismortui
PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d4jcob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jcob1 c.2.1.5 (B:22-162) automated matches {Haloarcula marismortui [TaxId: 2238]}
tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
rqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyislttsn
pvdllnrhlyeagdrsreqvig

SCOPe Domain Coordinates for d4jcob1:

Click to download the PDB-style file with coordinates for d4jcob1.
(The format of our PDB-style files is described here.)

Timeline for d4jcob1: