Lineage for d4jaoa_ (4jao A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1392123Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1392124Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1392829Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 1392830Protein automated matches [196909] (40 species)
    not a true protein
  7. 1393008Species Mycobacterium tuberculosis [TaxId:1773] [196910] (10 PDB entries)
  8. 1393031Domain d4jaoa_: 4jao A: [223648]
    automated match to d4japa_
    complexed with jao, plm

Details for d4jaoa_

PDB Entry: 4jao (more details), 2.05 Å

PDB Description: Crystal Structure of Mycobacterium tuberculosis PKS11 Reveals Intermediates in the Synthesis of Methyl-branched Alkylpyrones
PDB Compounds: (A:) Alpha-pyrone synthesis polyketide synthase-like Pks11

SCOPe Domain Sequences for d4jaoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jaoa_ c.95.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
sviagvfgalpphrysqseitdsfvefpglkeheeiirrlhaaakvngrhlvlplqqyps
ltdfgdaneifiekavdlgveallgalddanlrpsdidmiatatvtgvavpsldariagr
lglrpdvrrmplfglgcvagaagvarlrdylrgapddvavlvsvelcsltypavkptvss
lvgtalfgdgaaavvavgdrraeqvraggpdildsrsslypdslhimgwdvgshglrlrl
spdltnlierylandvttfldahrltkddigawvshpggpkvidavatslalppealelt
wrslgeignlssasilhilrdtiekrppsgsaglmlamgpgfctelvllrwr

SCOPe Domain Coordinates for d4jaoa_:

Click to download the PDB-style file with coordinates for d4jaoa_.
(The format of our PDB-style files is described here.)

Timeline for d4jaoa_:

  • d4jaoa_ is new in SCOPe 2.03-stable
  • d4jaoa_ does not appear in SCOPe 2.04