Lineage for d4j99c_ (4j99 C:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2543699Protein Fibroblast growth factor receptor 2 [75562] (1 species)
    PTK group; FGFR subfamily; membrane spanning protein tyrosine kinase
  7. 2543700Species Human (Homo sapiens) [TaxId:9606] [75563] (16 PDB entries)
    Uniprot P21802 467-765
  8. 2543704Domain d4j99c_: 4j99 C: [223634]
    automated match to d3ky2a_
    complexed with acp, mg, so4; mutant

Details for d4j99c_

PDB Entry: 4j99 (more details), 1.85 Å

PDB Description: crystal structure of fgf receptor 2 (fgfr2) kinase domain harboring the gain-of-function k659t mutation.
PDB Compounds: (C:) Fibroblast growth factor receptor 2

SCOPe Domain Sequences for d4j99c_:

Sequence, based on SEQRES records: (download)

>d4j99c_ d.144.1.7 (C:) Fibroblast growth factor receptor 2 {Human (Homo sapiens) [TaxId: 9606]}
elpedpkwefprdkltlgkplgegafgqvvmaeavgidkdkpkeavtvavkmlkddatek
dlsdlvsememmkmigkhkniinllgactqdgplyviveyaskgnlreylrarrppgmey
sydinrvpeeqmtfkdlvsctyqlargmeylasqkcihrdlaarnvlvtennvmkiadfg
lardinnidyyktttngrlpvkwmapealfdrvythqsdvwsfgvlmweiftlggspypg
ipveelfkllkeghrmdkpanctnelymmmrdcwhavpsqrptfkqlvedldriltlt

Sequence, based on observed residues (ATOM records): (download)

>d4j99c_ d.144.1.7 (C:) Fibroblast growth factor receptor 2 {Human (Homo sapiens) [TaxId: 9606]}
elpedpkwefprdkltlgkplgegafgqvvmaeavgidkdkpkeavtvavkmlkddatek
dlsdlvsememmkmigkhkniinllgactqdgplyviveyaskgnlreylrarrppgmey
sydqmtfkdlvsctyqlargmeylasqkcihrdlaarnvlvtennvmkiadfglardinn
idyyktttngrlpvkwmapealfdrvythqsdvwsfgvlmweiftlggspypgipveelf
kllkeghrmdkpanctnelymmmrdcwhavpsqrptfkqlvedldriltlt

SCOPe Domain Coordinates for d4j99c_:

Click to download the PDB-style file with coordinates for d4j99c_.
(The format of our PDB-style files is described here.)

Timeline for d4j99c_: