Lineage for d4j97d_ (4j97 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2981442Protein Fibroblast growth factor receptor 2 [75562] (1 species)
    PTK group; FGFR subfamily; membrane spanning protein tyrosine kinase
  7. 2981443Species Human (Homo sapiens) [TaxId:9606] [75563] (16 PDB entries)
    Uniprot P21802 467-765
  8. 2981476Domain d4j97d_: 4j97 D: [223629]
    automated match to d3ky2a_
    complexed with acp, so4; mutant

Details for d4j97d_

PDB Entry: 4j97 (more details), 2.55 Å

PDB Description: crystal structure of fgf receptor 2 (fgfr2) kinase domain harboring the pathogenic gain-of-function k659e mutation identified in endometrial cancer.
PDB Compounds: (D:) Fibroblast growth factor receptor 2

SCOPe Domain Sequences for d4j97d_:

Sequence, based on SEQRES records: (download)

>d4j97d_ d.144.1.7 (D:) Fibroblast growth factor receptor 2 {Human (Homo sapiens) [TaxId: 9606]}
yelpedpkwefprdkltlgkplgegafgqvvmaeavgidkdkpkeavtvavkmlkddate
kdlsdlvsememmkmigkhkniinllgactqdgplyviveyaskgnlreylrarrppgme
ysydinrvpeeqmtfkdlvsctyqlargmeylasqkcihrdlaarnvlvtennvmkiadf
glardinnidyykettngrlpvkwmapealfdrvythqsdvwsfgvlmweiftlggspyp
gipveelfkllkeghrmdkpanctnelymmmrdcwhavpsqrptfkqlvedldriltlt

Sequence, based on observed residues (ATOM records): (download)

>d4j97d_ d.144.1.7 (D:) Fibroblast growth factor receptor 2 {Human (Homo sapiens) [TaxId: 9606]}
yelpedpkwefprdkltlgkplgqvvmaeavgidkdkpkeavtvavkmlkddatekdlsd
lvsememmkmigkhkniinllgactqdgplyviveyaskgnlreylrarrpprvpeeqmt
fkdlvsctyqlargmeylasqkcihrdlaarnvlvtennvmkiadfglardinnidyyke
ttngrlpvkwmapealfdrvythqsdvwsfgvlmweiftlggspypgipveelfkllkeg
hrmdkpanctnelymmmrdcwhavpsqrptfkqlvedldriltlt

SCOPe Domain Coordinates for d4j97d_:

Click to download the PDB-style file with coordinates for d4j97d_.
(The format of our PDB-style files is described here.)

Timeline for d4j97d_: