Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Fibroblast growth factor receptor 2 [75562] (1 species) PTK group; FGFR subfamily; membrane spanning protein tyrosine kinase |
Species Human (Homo sapiens) [TaxId:9606] [75563] (16 PDB entries) Uniprot P21802 467-765 |
Domain d4j96b_: 4j96 B: [223625] automated match to d3ky2a_ complexed with acp, flc, mg, so4; mutant |
PDB Entry: 4j96 (more details), 2.3 Å
SCOPe Domain Sequences for d4j96b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j96b_ d.144.1.7 (B:) Fibroblast growth factor receptor 2 {Human (Homo sapiens) [TaxId: 9606]} gvseyelpedpkwefprdkltlgkplgegafgqvvmaeavgidkdkpkeavtvavkmlkd datekdlsdlvsememmkmigkhkniinllgactqdgplyviveyaskgnlreylrarrp pgmeysydinrvpeeqmtfkdlvsctyqlargmeylasqkcihrdlaarnvlvtennvmk iadfglardinnidyykmttngrlpvkwmapealfdrvythqsdvwsfgvlmweiftlgg spypgipveelfkllkeghrmdkpanctnelymmmrdcwhavpsqrptfkqlvedldril tlttn
Timeline for d4j96b_: