Lineage for d4j96a_ (4j96 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1433536Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1433537Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1433619Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1435613Protein automated matches [190091] (11 species)
    not a true protein
  7. 1435681Species Human (Homo sapiens) [TaxId:9606] [188447] (418 PDB entries)
  8. 1435862Domain d4j96a_: 4j96 A: [223624]
    automated match to d3ky2a_
    complexed with acp, flc, mg, so4; mutant

Details for d4j96a_

PDB Entry: 4j96 (more details), 2.3 Å

PDB Description: crystal structure of fgf receptor 2 (fgfr2) kinase domain harboring the pathogenic gain-of-function k659m mutation identified in cervical cancer.
PDB Compounds: (A:) Fibroblast growth factor receptor 2

SCOPe Domain Sequences for d4j96a_:

Sequence, based on SEQRES records: (download)

>d4j96a_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agvseyelpedpkwefprdkltlgkplgegafgqvvmaeavgidkdkpkeavtvavkmlk
ddatekdlsdlvsememmkmigkhkniinllgactqdgplyviveyaskgnlreylrarr
ppgmeysydinrvpeeqmtfkdlvsctyqlargmeylasqkcihrdlaarnvlvtennvm
kiadfglardinnidyykmttngrlpvkwmapealfdrvythqsdvwsfgvlmweiftlg
gspypgipveelfkllkeghrmdkpanctnelymmmrdcwhavpsqrptfkqlvedldri
ltlttn

Sequence, based on observed residues (ATOM records): (download)

>d4j96a_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agvseyelpedpkwefprdkltlgkplgegafgqvvmaeavgidkdkpkeavtvavkmlk
ddatekdlsdlvsememmkmigkhkniinllgactqdgplyviveyaskgnlreylrarr
ppsydinrvpeeqmtfkdlvsctyqlargmeylasqkcihrdlaarnvlvtennvmkiad
fglardinnidyykmttngrlpvkwmapealfdrvythqsdvwsfgvlmweiftlggspy
pgipveelfkllkeghrmdkpanctnelymmmrdcwhavpsqrptfkqlvedldriltlt
tn

SCOPe Domain Coordinates for d4j96a_:

Click to download the PDB-style file with coordinates for d4j96a_.
(The format of our PDB-style files is described here.)

Timeline for d4j96a_: