Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.0: automated matches [191495] (1 protein) not a true family |
Protein automated matches [190805] (17 species) not a true protein |
Species Protobothrops mucrosquamatus [TaxId:103944] [226718] (1 PDB entry) |
Domain d4j4mb_: 4j4m B: [223552] automated match to d1r54a_ complexed with zn |
PDB Entry: 4j4m (more details), 1.8 Å
SCOPe Domain Sequences for d4j4mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j4mb_ d.92.1.0 (B:) automated matches {Protobothrops mucrosquamatus [TaxId: 103944]} rfpqryvmlaivadhgmvtkysgnssaittrvhqmvshvtemysplniattlsllriwss kdlitvqsdssvtlgsfgdwrkvvllsqqahdcaflntatalddstiglaysngmcdpkf svglvqdhssnvfmvavtmthelghnlgmahdeaggcacsscimspaassgpsklfsdcs kddyqtfltntnpqcilnap
Timeline for d4j4mb_: