SCOPe 2.03: Domain d4j4mb_: 4j4m B:

Lineage for d4j4mb_ (4j4m B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.0: automated matches [191495] (1 protein)
   not a true family

6. Protein automated matches [190805] (8 species)
   not a true protein

7. Species Protobothrops mucrosquamatus [TaxId:103944] [226718] (1 PDB entry)

8. Domain d4j4mb_: 4j4m B: [223552]
   automated match to d1r54a_
   complexed with zn

Details for d4j4mb_

PDB Entry: 4j4m, 1.8 Å

PDB Description: Crystal structure of TM-1, a Trimeresurus mucrosquamatus venom metalloproteinase

PDB Compounds: (B:) zinc-dependent metalloproteinase

SCOPe Domain Sequences for d4j4mb_:

Sequence; same for both SEQRES and ATOM records:

>d4j4mb_ d.92.1.0 (B:) automated matches {Protobothrops mucrosquamatus [TaxId: 103944]}
rfpqryvmlaivadhgmvtkysgnssaittrvhqmvshvtemysplniattlsllriwss
kdlitvqsdssvtlgsfgdwrkvvllsqqahdcaflntatalddstiglaysngmcdpkf
svglvqdhssnvfmvavtmthelghnlgmahdeaggcacsscimspaassgpsklfsdcs
kddyqtfltntnpqcilnap

Timeline for d4j4mb_:

• d4j4mb_ is new in SCOPe 2.03-stable
  
• d4j4mb_ appears in SCOPe 2.04
  
• d4j4mb_ appears in the current release, SCOPe 2.08