Lineage for d4j4mb_ (4j4m B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964873Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. 2964874Protein automated matches [190805] (20 species)
    not a true protein
  7. 2965078Species Protobothrops mucrosquamatus [TaxId:103944] [226718] (1 PDB entry)
  8. 2965080Domain d4j4mb_: 4j4m B: [223552]
    automated match to d1r54a_
    complexed with zn

Details for d4j4mb_

PDB Entry: 4j4m (more details), 1.8 Å

PDB Description: Crystal structure of TM-1, a Trimeresurus mucrosquamatus venom metalloproteinase
PDB Compounds: (B:) zinc-dependent metalloproteinase

SCOPe Domain Sequences for d4j4mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j4mb_ d.92.1.0 (B:) automated matches {Protobothrops mucrosquamatus [TaxId: 103944]}
rfpqryvmlaivadhgmvtkysgnssaittrvhqmvshvtemysplniattlsllriwss
kdlitvqsdssvtlgsfgdwrkvvllsqqahdcaflntatalddstiglaysngmcdpkf
svglvqdhssnvfmvavtmthelghnlgmahdeaggcacsscimspaassgpsklfsdcs
kddyqtfltntnpqcilnap

SCOPe Domain Coordinates for d4j4mb_:

Click to download the PDB-style file with coordinates for d4j4mb_.
(The format of our PDB-style files is described here.)

Timeline for d4j4mb_: