SCOPe 2.08: Domain d4j2fa1: 4j2f A:3-82

Lineage for d4j2fa1 (4j2f A:3-82)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Castor bean (Ricinus communis) [TaxId:3988] [226601] (1 PDB entry)

8. Domain d4j2fa1: 4j2f A:3-82 [223534]
   Other proteins in same PDB: d4j2fa2
   automated match to d1gwca2
   complexed with gol

Details for d4j2fa1

PDB Entry: 4j2f, 1.9 Å

PDB Description: Crystal structure of a glutathione transferase family member from Ricinus communis, target EFI-501866

PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d4j2fa1:

Sequence; same for both SEQRES and ATOM records:

>d4j2fa1 c.47.1.0 (A:3-82) automated matches {Castor bean (Ricinus communis) [TaxId: 3988]}
evlklhgawpspfscrviwalklkgipyeyveedlfnksplllqynpvhkkipvlvhggk
picestiileyldetwpenp

Timeline for d4j2fa1:

• d4j2fa1 first appeared in SCOPe 2.03
  
• d4j2fa1 appears in SCOPe 2.07