Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (195 species) not a true protein |
Species Castor bean (Ricinus communis) [TaxId:3988] [226601] (1 PDB entry) |
Domain d4j2fa1: 4j2f A:3-82 [223534] Other proteins in same PDB: d4j2fa2 automated match to d1gwca2 complexed with gol |
PDB Entry: 4j2f (more details), 1.9 Å
SCOPe Domain Sequences for d4j2fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j2fa1 c.47.1.0 (A:3-82) automated matches {Castor bean (Ricinus communis) [TaxId: 3988]} evlklhgawpspfscrviwalklkgipyeyveedlfnksplllqynpvhkkipvlvhggk picestiileyldetwpenp
Timeline for d4j2fa1: