Lineage for d4j1uc1 (4j1u C:1-112)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2034475Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)
  8. 2034995Domain d4j1uc1: 4j1u C:1-112 [223524]
    Other proteins in same PDB: d4j1ua2, d4j1uc2, d4j1ue2
    automated match to d1rhha1

Details for d4j1uc1

PDB Entry: 4j1u (more details), 2.58 Å

PDB Description: Crystal structure of antibody 93F3 unstable variant
PDB Compounds: (C:) antibody 93F3 Light chain

SCOPe Domain Sequences for d4j1uc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j1uc1 b.1.1.0 (C:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqsptkliywastr
esgvpdrftgsgsgtdftltissvqaedlavyyckqsydlptfgagtklelk

SCOPe Domain Coordinates for d4j1uc1:

Click to download the PDB-style file with coordinates for d4j1uc1.
(The format of our PDB-style files is described here.)

Timeline for d4j1uc1: