Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
Domain d4j1ua1: 4j1u A:1-112 [223522] Other proteins in same PDB: d4j1ua2, d4j1uc2, d4j1ue2 automated match to d1rhha1 |
PDB Entry: 4j1u (more details), 2.58 Å
SCOPe Domain Sequences for d4j1ua1:
Sequence, based on SEQRES records: (download)
>d4j1ua1 b.1.1.0 (A:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]} divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqsptkliywastr esgvpdrftgsgsgtdftltissvqaedlavyyckqsydlptfgagtklelk
>d4j1ua1 b.1.1.0 (A:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]} divmsqspsslavsagekvtmsckssqsllnknylawyqqkpgqsptkliywastresgv pdrftgsgsgtdftltissvqaedlavyyckqsydlptfgagtklelk
Timeline for d4j1ua1:
View in 3D Domains from other chains: (mouse over for more information) d4j1uc1, d4j1uc2, d4j1ue1, d4j1ue2 |