Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.0: automated matches [191346] (1 protein) not a true family |
Protein automated matches [190246] (54 species) not a true protein |
Species Ruegeria pomeroyi [TaxId:246200] [226684] (3 PDB entries) |
Domain d4izca_: 4izc A: [223488] automated match to d2zqqa_ complexed with 1gz |
PDB Entry: 4izc (more details), 1.8 Å
SCOPe Domain Sequences for d4izca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4izca_ c.14.1.0 (A:) automated matches {Ruegeria pomeroyi [TaxId: 246200]} qdvtsgysnldldlrdngvcvvtlnrpdkrnaldvatieelvtffstahrkgvravvltg agdhfcagldlvehwkadrsaddfmhvclrwheafnkmeyggvpiiaalrgavvggglal asaahlrvmdqstyfalpegqrgiftgggatirvsdmigkyrmidmiltgrvyqgqeaad lglaqyitegssfdkameladkiasnlpltnfaicsaishmqnmsgldaayaeafvggiv ntqpaarerle
Timeline for d4izca_: