Lineage for d4izca_ (4izc A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2112071Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2112072Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2113065Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2113066Protein automated matches [190246] (54 species)
    not a true protein
  7. 2113604Species Ruegeria pomeroyi [TaxId:246200] [226684] (3 PDB entries)
  8. 2113609Domain d4izca_: 4izc A: [223488]
    automated match to d2zqqa_
    complexed with 1gz

Details for d4izca_

PDB Entry: 4izc (more details), 1.8 Å

PDB Description: Crystal structure of DmdD E121A in complex with MTA-CoA
PDB Compounds: (A:) Enoyl-CoA hydratase/isomerase family protein

SCOPe Domain Sequences for d4izca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4izca_ c.14.1.0 (A:) automated matches {Ruegeria pomeroyi [TaxId: 246200]}
qdvtsgysnldldlrdngvcvvtlnrpdkrnaldvatieelvtffstahrkgvravvltg
agdhfcagldlvehwkadrsaddfmhvclrwheafnkmeyggvpiiaalrgavvggglal
asaahlrvmdqstyfalpegqrgiftgggatirvsdmigkyrmidmiltgrvyqgqeaad
lglaqyitegssfdkameladkiasnlpltnfaicsaishmqnmsgldaayaeafvggiv
ntqpaarerle

SCOPe Domain Coordinates for d4izca_:

Click to download the PDB-style file with coordinates for d4izca_.
(The format of our PDB-style files is described here.)

Timeline for d4izca_: