Lineage for d4kbpc1 (4kbp C:9-120)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658453Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (1 family) (S)
  5. 658454Family b.1.12.1: Purple acid phosphatase, N-terminal domain [49364] (1 protein)
  6. 658455Protein Purple acid phosphatase, N-terminal domain [49365] (2 species)
  7. 658456Species Kidney bean (Phaseolus vulgaris) [TaxId:3885] [49366] (3 PDB entries)
  8. 658459Domain d4kbpc1: 4kbp C:9-120 [22347]
    Other proteins in same PDB: d4kbpa2, d4kbpb2, d4kbpc2, d4kbpd2

Details for d4kbpc1

PDB Entry: 4kbp (more details), 2.7 Å

PDB Description: kidney bean purple acid phosphatase
PDB Compounds: (C:) purple acid phosphatase

SCOP Domain Sequences for d4kbpc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kbpc1 b.1.12.1 (C:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}
rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr
iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp

SCOP Domain Coordinates for d4kbpc1:

Click to download the PDB-style file with coordinates for d4kbpc1.
(The format of our PDB-style files is described here.)

Timeline for d4kbpc1: