Lineage for d4ixke_ (4ixk E:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314152Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2315283Protein Non-hem ferritin [63524] (7 species)
  7. 2315309Species Pseudo-nitzschia multiseries [TaxId:37319] [188675] (9 PDB entries)
  8. 2315350Domain d4ixke_: 4ixk E: [223463]
    automated match to d3e6sa_
    complexed with fe

Details for d4ixke_

PDB Entry: 4ixk (more details), 2.1 Å

PDB Description: anaerobic crystal structure of iron soaked (2 h) ferritin from pseudo- nitzschia multiseries
PDB Compounds: (E:) Ferritin

SCOPe Domain Sequences for d4ixke_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ixke_ a.25.1.1 (E:) Non-hem ferritin {Pseudo-nitzschia multiseries [TaxId: 37319]}
eelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfank
rnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafln
pfhlqqvneedkigsilakvtdenrtpgllrsldvv

SCOPe Domain Coordinates for d4ixke_:

Click to download the PDB-style file with coordinates for d4ixke_.
(The format of our PDB-style files is described here.)

Timeline for d4ixke_: