Lineage for d4iv6b1 (4iv6 B:2-226)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2246106Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 2246107Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 2246252Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 2246253Protein automated matches [226934] (25 species)
    not a true protein
  7. 2246371Species Mycobacterium smegmatis [TaxId:246196] [226167] (3 PDB entries)
  8. 2246378Domain d4iv6b1: 4iv6 B:2-226 [223419]
    Other proteins in same PDB: d4iv6a2, d4iv6b2
    automated match to d1ukwa2
    complexed with fda

Details for d4iv6b1

PDB Entry: 4iv6 (more details), 2 Å

PDB Description: x-ray crystal structure of an isovaleryl-coa dehydrogenase from mycobacterium smegmatis
PDB Compounds: (B:) Acyl-CoA dehydrogenase FadE3

SCOPe Domain Sequences for d4iv6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iv6b1 e.6.1.0 (B:2-226) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
altaeeetivktvhdfvekqvkpvvrelehantypeelietmkeigifglaipepygfga
vsmpcyvqvaeelargwmslagamgghtvvskllllfgteeqkqkylprmatgelratma
ltepgggsdlqamrtvarrdgddyvingsktwisnarrsdlvalmcktdpdaqpahkgvs
illvekvpgfdvsrdlpklgykgvescelnftdarvpvssllgdd

SCOPe Domain Coordinates for d4iv6b1:

Click to download the PDB-style file with coordinates for d4iv6b1.
(The format of our PDB-style files is described here.)

Timeline for d4iv6b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4iv6b2