Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds) |
Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
Family e.6.1.0: automated matches [227203] (1 protein) not a true family |
Protein automated matches [226934] (25 species) not a true protein |
Species Mycobacterium smegmatis [TaxId:246196] [226167] (3 PDB entries) |
Domain d4iv6a1: 4iv6 A:3-226 [223417] Other proteins in same PDB: d4iv6a2, d4iv6b2 automated match to d1ukwa2 complexed with fda |
PDB Entry: 4iv6 (more details), 2 Å
SCOPe Domain Sequences for d4iv6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iv6a1 e.6.1.0 (A:3-226) automated matches {Mycobacterium smegmatis [TaxId: 246196]} ltaeeetivktvhdfvekqvkpvvrelehantypeelietmkeigifglaipepygfgav smpcyvqvaeelargwmslagamgghtvvskllllfgteeqkqkylprmatgelratmal tepgggsdlqamrtvarrdgddyvingsktwisnarrsdlvalmcktdpdaqpahkgvsi llvekvpgfdvsrdlpklgykgvescelnftdarvpvssllgdd
Timeline for d4iv6a1: