Lineage for d4iuyf_ (4iuy F:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1830531Species Acinetobacter baumannii [TaxId:405416] [226610] (1 PDB entry)
  8. 1830537Domain d4iuyf_: 4iuy F: [223400]
    automated match to d2rhcb_

Details for d4iuyf_

PDB Entry: 4iuy (more details), 2.38 Å

PDB Description: crystal structure of short-chain dehydrogenase/reductase (apo-form) from a. baumannii clinical strain wm99c
PDB Compounds: (F:) Short chain dehydrogenase/reductase

SCOPe Domain Sequences for d4iuyf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iuyf_ c.2.1.0 (F:) automated matches {Acinetobacter baumannii [TaxId: 405416]}
nifdvkdkyilitgassglghhiaelfakeganivicarrlerlkeleshikneygvqvy
tfaldvndrsavkdmlssleaegvtidvlinnagvsdtkrfldyndedwdkivdtnlkap
wqcaqevvqhmikaerkgsiinitsilsqstnlgvspycaskaglrhltevmavelarfg
invnaiapgymiteineeyltsevgqqllkkiptrkfvefddlngpllllasqagqgitg
ieikvdgghsaap

SCOPe Domain Coordinates for d4iuyf_:

Click to download the PDB-style file with coordinates for d4iuyf_.
(The format of our PDB-style files is described here.)

Timeline for d4iuyf_: