SCOPe 2.03: Domain d4iuyf_: 4iuy F:

Lineage for d4iuyf_ (4iuy F:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (159 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:405416] [226610] (1 PDB entry)

8. Domain d4iuyf_: 4iuy F: [223400]
   automated match to d2rhcb_

Details for d4iuyf_

PDB Entry: 4iuy, 2.38 Å

PDB Description: crystal structure of short-chain dehydrogenase/reductase (apo-form) from a. baumannii clinical strain wm99c

PDB Compounds: (F:) Short chain dehydrogenase/reductase

SCOPe Domain Sequences for d4iuyf_:

Sequence; same for both SEQRES and ATOM records:

>d4iuyf_ c.2.1.0 (F:) automated matches {Acinetobacter baumannii [TaxId: 405416]}
nifdvkdkyilitgassglghhiaelfakeganivicarrlerlkeleshikneygvqvy
tfaldvndrsavkdmlssleaegvtidvlinnagvsdtkrfldyndedwdkivdtnlkap
wqcaqevvqhmikaerkgsiinitsilsqstnlgvspycaskaglrhltevmavelarfg
invnaiapgymiteineeyltsevgqqllkkiptrkfvefddlngpllllasqagqgitg
ieikvdgghsaap

Timeline for d4iuyf_:

• d4iuyf_ is new in SCOPe 2.03-stable
  
• d4iuyf_ appears in SCOPe 2.04
  
• d4iuyf_ appears in the current release, SCOPe 2.08