SCOPe 2.08: Domain d4iuob1: 4iuo B:1-252

Lineage for d4iuob1 (4iuo B:1-252)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (94 species)
   not a true protein

7. Species Salmonella enterica [TaxId:99287] [226761] (5 PDB entries)

8. Domain d4iuob1: 4iuo B:1-252 [223394]
   Other proteins in same PDB: d4iuoa2, d4iuob2
   automated match to d4h3dd_
   complexed with qic; mutant

Details for d4iuob1

PDB Entry: 4iuo, 1.8 Å

PDB Description: 1.8 angstrom crystal structure of the salmonella enterica 3- dehydroquinate dehydratase (arod) k170m mutant in complex with quinate

PDB Compounds: (B:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d4iuob1:

Sequence; same for both SEQRES and ATOM records:

>d4iuob1 c.1.10.0 (B:1-252) automated matches {Salmonella enterica [TaxId: 99287]}
mktvtvrdlvvgegapkiivslmgktitdvksealayreadfdilewrvdhfanvttaes
vleaagaireiitdkpllftfrsakeggeqalttgqyidlnraavdsglvdmidlelftg
ddevkatvgyahqhnvavimsnhdfhktpaaeeivqrlrkmqelgadipmiavmpqtkad
vltlltatvemqeryadrpiitmsmsktgvisrlagevfgsaatfgavkkasapgqisva
dlrtvltilhqa

Timeline for d4iuob1:

• d4iuob1 first appeared in SCOPe 2.03, called d4iuob_
  
• d4iuob1 appears in SCOPe 2.07