Lineage for d4ittb_ (4itt B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314152Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2315283Protein Non-hem ferritin [63524] (7 species)
  7. 2315309Species Pseudo-nitzschia multiseries [TaxId:37319] [188675] (9 PDB entries)
  8. 2315355Domain d4ittb_: 4itt B: [223369]
    automated match to d3e6sa_
    complexed with fe

Details for d4ittb_

PDB Entry: 4itt (more details), 2.1 Å

PDB Description: crystal structure of iron soaked (5 min) ferritin from pseudo- nitzschia multiseries
PDB Compounds: (B:) Ferritin

SCOPe Domain Sequences for d4ittb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ittb_ a.25.1.1 (B:) Non-hem ferritin {Pseudo-nitzschia multiseries [TaxId: 37319]}
seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfan
krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl
npfhlqqvneedkigsilakvtdenrtpgllrsldvvsf

SCOPe Domain Coordinates for d4ittb_:

Click to download the PDB-style file with coordinates for d4ittb_.
(The format of our PDB-style files is described here.)

Timeline for d4ittb_: