SCOPe 2.05: Domain d4it1b2: 4it1 B:136-424

Lineage for d4it1b2 (4it1 B:136-424)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (71 species)
   not a true protein

7. Species Pseudomonas fluorescens [TaxId:205922] [226580] (1 PDB entry)

8. Domain d4it1b2: 4it1 B:136-424 [223363]
   Other proteins in same PDB: d4it1a1, d4it1b1, d4it1c1, d4it1d1
   automated match to d1ec7a1
   complexed with bct, k, mg, tla

Details for d4it1b2

PDB Entry: 4it1, 2.2 Å

PDB Description: crystal structure of enolase pfl01_3283 (target efi-502286) from pseudomonas fluorescens pf0-1 with bound magnesium, potassium and tartrate

PDB Compounds: (B:) Putative glucarate dehydratase

SCOPe Domain Sequences for d4it1b2:

Sequence; same for both SEQRES and ATOM records:

>d4it1b2 c.1.11.0 (B:136-424) automated matches {Pseudomonas fluorescens [TaxId: 205922]}
gavrdevpfsaylffkyaqhvdspykpdnwgealneqqivaqaarmieaygfksiklkag
tlppehevacikalkkafpgyplridpngnwsletsirmaellgddlqyyedptpglegm
aelhkrtglplatnmvvtdfdefrrsvaqnsvqivladhhywgglrdtqtlakmcdtfgl
gvsmhsnshlgislmamahvaaavpnldyacdthypwqepdeevikggklpivdgcvkit
rapglgleldhdqlgklhdqyltcgirqrddvrqmqrykpdwkalkprf

Timeline for d4it1b2:

• d4it1b2 first appeared in SCOPe 2.03
  
• d4it1b2 appears in SCOPe 2.04
  
• d4it1b2 appears in SCOPe 2.06
  
• d4it1b2 appears in the current release, SCOPe 2.08