Lineage for d4it1b1 (4it1 B:0-135)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904959Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1904960Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1905229Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1905230Protein automated matches [226922] (83 species)
    not a true protein
  7. 1905702Species Pseudomonas fluorescens [TaxId:205922] [226578] (1 PDB entry)
  8. 1905704Domain d4it1b1: 4it1 B:0-135 [223362]
    Other proteins in same PDB: d4it1a2, d4it1b2, d4it1c2, d4it1d2
    automated match to d1ec7a2
    complexed with bct, k, mg, tla

Details for d4it1b1

PDB Entry: 4it1 (more details), 2.2 Å

PDB Description: crystal structure of enolase pfl01_3283 (target efi-502286) from pseudomonas fluorescens pf0-1 with bound magnesium, potassium and tartrate
PDB Compounds: (B:) Putative glucarate dehydratase

SCOPe Domain Sequences for d4it1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4it1b1 d.54.1.0 (B:0-135) automated matches {Pseudomonas fluorescens [TaxId: 205922]}
smkitrvtvtpiafrdppllnasgihepfalrsiieiesdngyiglgesygdapalaiqq
qvqsqligldpfnlnqlrrivqttvaahkpaslagaelapgshaskavsnaysafevafl
dlqarylnvplvdllg

SCOPe Domain Coordinates for d4it1b1:

Click to download the PDB-style file with coordinates for d4it1b1.
(The format of our PDB-style files is described here.)

Timeline for d4it1b1: