Lineage for d4irha_ (4irh A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1258750Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1260111Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1260112Protein automated matches [190154] (41 species)
    not a true protein
  7. 1260202Species Human (Homo sapiens) [TaxId:9606] [186924] (7 PDB entries)
  8. 1260213Domain d4irha_: 4irh A: [223335]
    automated match to d1mdmb_

Details for d4irha_

PDB Entry: 4irh (more details), 2.1 Å

PDB Description: Auto-inhibited ERG Ets domain
PDB Compounds: (A:) Transcriptional regulator ERG

SCOPe Domain Sequences for d4irha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4irha_ a.4.5.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ssrlanpgsgqiqlwqfllellsdssnsscitwegtngefkmtdpdevarrwgerkskpn
mnydklsralryyydknimtkvhgkryaykfdfhgiaqalqp

SCOPe Domain Coordinates for d4irha_:

Click to download the PDB-style file with coordinates for d4irha_.
(The format of our PDB-style files is described here.)

Timeline for d4irha_: