Lineage for d4iqga_ (4iqg A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1349962Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1349963Protein automated matches [190069] (159 species)
    not a true protein
  7. 1350894Species Polaromonas sp. [TaxId:296591] [226304] (2 PDB entries)
  8. 1350895Domain d4iqga_: 4iqg A: [223320]
    automated match to d2c07a1
    complexed with fmt, gol, nap, peg

Details for d4iqga_

PDB Entry: 4iqg (more details), 1.85 Å

PDB Description: crystal structure of bpro0239 oxidoreductase from polaromonas sp. js666 in nadp bound form
PDB Compounds: (A:) Short-chain dehydrogenase/reductase SDR

SCOPe Domain Sequences for d4iqga_:

Sequence, based on SEQRES records: (download)

>d4iqga_ c.2.1.0 (A:) automated matches {Polaromonas sp. [TaxId: 296591]}
lskvvlitggsrgigaasallaarqgyavavnyasnsaaadevvrqireaggqalavqad
vakerevlamfetvdaqlgrlsalvnnagvvdqttrvdgitlerlqrmfeinvfgsflca
reavkrmstryggsggsivnvssaaarlgspgqyvdyaaakgaidtftlglakevategi
rvnavrpgiietdihasgglpnrardvapqvpmqragtarevaeaivwllgdqasyttga
lldvtggr

Sequence, based on observed residues (ATOM records): (download)

>d4iqga_ c.2.1.0 (A:) automated matches {Polaromonas sp. [TaxId: 296591]}
lskvvlitggsrgigaasallaarqgyavavnyasnsaaadevvrqireaggqalavqad
vakerevlamfetvdaqlgrlsalvnnagvvdqttrvdgitlerlqrmfeinvfgsflca
reavkrmstryggsggsivnvssaaarlgspgqyvdyaaakgaidtftlglakevategi
rvnavrpgiietdvapqvpmqragtarevaeaivwllgdqasyttgalldvtggr

SCOPe Domain Coordinates for d4iqga_:

Click to download the PDB-style file with coordinates for d4iqga_.
(The format of our PDB-style files is described here.)

Timeline for d4iqga_: