Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) |
Family c.1.12.0: automated matches [191427] (1 protein) not a true family |
Protein automated matches [190614] (15 species) not a true protein |
Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [226572] (3 PDB entries) |
Domain d4iqdb_: 4iqd B: [223309] automated match to d3eoob_ complexed with pyr |
PDB Entry: 4iqd (more details), 2 Å
SCOPe Domain Sequences for d4iqdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iqdb_ c.1.12.0 (B:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} qstqeelanrfralveaneilqipgahdamaalvarntgflalylsgaaytaskglpdlg ivtstevaerardlvratdlpvlvdidtgfggvlnvartavemveakvaavqiedqqlpk kcghlngkklvtteelvqkikaikevapslyivartdargvegldeaieranayvkagad aifpealqseeefrlfnskvnapllanmtefgktpyysaeefanmgfqmviypvtslrva akayenvftliketgsqkdalsnmqtrselyetisyhdfeeldtgiakt
Timeline for d4iqdb_: