Class a: All alpha proteins [46456] (285 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein automated matches [226848] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [224956] (35 PDB entries) |
Domain d4iqab2: 4iqa B:92-240 [223307] Other proteins in same PDB: d4iqaa1, d4iqab1 automated match to d1k0ma1 mutant |
PDB Entry: 4iqa (more details), 2.49 Å
SCOPe Domain Sequences for d4iqab2:
Sequence, based on SEQRES records: (download)
>d4iqab2 a.45.1.1 (B:92-240) automated matches {Human (Homo sapiens) [TaxId: 9606]} rypklaalnpesntagldifakfsayiknsnpalndnlekgllkalkvldnyltsplpee vdetsaedegvsqrkfldgneltladcnllpklhivqvvckkyrgftipeafrgvhryls nayareefastcpddelielayeqvakal
>d4iqab2 a.45.1.1 (B:92-240) automated matches {Human (Homo sapiens) [TaxId: 9606]} rypklaalnpesntagldifakfsayiknsnpalndnlekgllkalkvldnyltsplprk fldgneltladcnllpklhivqvvckkyrgftipeafrgvhrylsnayareefastcpdd elielayeqvakal
Timeline for d4iqab2: