Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.0: automated matches [191322] (1 protein) not a true family |
Protein automated matches [190120] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186843] (28 PDB entries) |
Domain d4ip3b_: 4ip3 B: [223290] automated match to d3ptfb_ |
PDB Entry: 4ip3 (more details), 2.3 Å
SCOPe Domain Sequences for d4ip3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ip3b_ d.20.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} aglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpee ypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpl andvaeqwktneaqaietarawtrlyamnni
Timeline for d4ip3b_: