SCOPe 2.08: Domain d4im7a2: 4im7 A:281-487

Lineage for d4im7a2 (4im7 A:281-487)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (46 species)
   not a true protein

7. Species Escherichia coli [TaxId:199310] [226566] (1 PDB entry)

8. Domain d4im7a2: 4im7 A:281-487 [223251]
   Other proteins in same PDB: d4im7a1
   automated match to d1lj8a3
   complexed with cs2, nai, so4

Details for d4im7a2

PDB Entry: 4im7, 1.9 Å

PDB Description: crystal structure of fructuronate reductase (ydfi) from e. coli cft073 (efi target efi-506389) complexed with nadh and d-mannonate

PDB Compounds: (A:) Hypothetical oxidoreductase ydfI

SCOPe Domain Sequences for d4im7a2:

Sequence; same for both SEQRES and ATOM records:

>d4im7a2 a.100.1.0 (A:281-487) automated matches {Escherichia coli [TaxId: 199310]}
dvlpyeemklrmlngshsflaylgylagyqhindcmedehyrhaaytlmlqeqaptlkvq
gvdlqdyanrlierysnpalrhrtwqiamdgsqklpqrmldsvrwhlahdskfdllalgv
agwmryvggvdeqgnpieisdpllpviqkavqssaegtarvqsllaikaifgddlpgnsl
fttkvteaylsllahgakatvakysvk

Timeline for d4im7a2:

• d4im7a2 first appeared in SCOPe 2.03
  
• d4im7a2 appears in SCOPe 2.07