Lineage for d1pdka1 (1pdk A:1-124)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 291332Superfamily b.1.11: PapD-like [49354] (2 families) (S)
    contains PP switch between strands D and C'
  5. 291333Family b.1.11.1: Pilus chaperone [49355] (4 proteins)
  6. 291369Protein Pilus chaperone PapD, N-domain [49356] (1 species)
    consists of two domains of this fold; domain 2 has an additional strand at the C-terminus
  7. 291370Species Escherichia coli [TaxId:562] [49357] (5 PDB entries)
  8. 291377Domain d1pdka1: 1pdk A:1-124 [22322]
    Other proteins in same PDB: d1pdka2, d1pdkb_

Details for d1pdka1

PDB Entry: 1pdk (more details), 2.4 Å

PDB Description: papd-papk chaperone-pilus subunit complex from e.coli p pilus

SCOP Domain Sequences for d1pdka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pdka1 b.1.11.1 (A:1-124) Pilus chaperone PapD, N-domain {Escherichia coli}
avsldrtravfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrle
pgaksmvrlsttpdisklpqdreslfyfnlreipprsekanvlqialqtkiklfyrpaai
ktrp

SCOP Domain Coordinates for d1pdka1:

Click to download the PDB-style file with coordinates for d1pdka1.
(The format of our PDB-style files is described here.)

Timeline for d1pdka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pdka2
View in 3D
Domains from other chains:
(mouse over for more information)
d1pdkb_