Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.11: PapD-like [49354] (2 families) contains PP switch between strands D and C' |
Family b.1.11.1: Pilus chaperone [49355] (4 proteins) |
Protein Pilus chaperone PapD, N-domain [49356] (1 species) consists of two domains of this fold; domain 2 has an additional strand at the C-terminus |
Species Escherichia coli [TaxId:562] [49357] (5 PDB entries) |
Domain d1pdka1: 1pdk A:1-124 [22322] Other proteins in same PDB: d1pdka2, d1pdkb_ |
PDB Entry: 1pdk (more details), 2.4 Å
SCOP Domain Sequences for d1pdka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pdka1 b.1.11.1 (A:1-124) Pilus chaperone PapD, N-domain {Escherichia coli} avsldrtravfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrle pgaksmvrlsttpdisklpqdreslfyfnlreipprsekanvlqialqtkiklfyrpaai ktrp
Timeline for d1pdka1: