SCOPe 2.05: Domain d4iivd_: 4iiv D:

Lineage for d4iivd_ (4iiv D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (203 species)
   not a true protein

7. Species Escherichia coli [TaxId:199310] [226553] (3 PDB entries)

8. Domain d4iivd_: 4iiv D: [223214]
   automated match to d2c07a1
   complexed with nap

Details for d4iivd_

PDB Entry: 4iiv, 2.5 Å

PDB Description: crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from escherichia coli strain cft073 complexed with nadp+ at 2.5 a resolution

PDB Compounds: (D:) 3-oxoacyl-[acyl-carrier protein] reductase

SCOPe Domain Sequences for d4iivd_:

Sequence; same for both SEQRES and ATOM records:

>d4iivd_ c.2.1.0 (D:) automated matches {Escherichia coli [TaxId: 199310]}
srsvlvtgaskgigraiarqlaadgfnigvhyhrdaagaqetlnaivanggngrllsfdv
anreqcrevleheiaqhgawygvvsnagiardaafpalsnddwdavihtnldsfynviqp
cimpmigarqggriitlssvsgvmgnrgqvnysaakagiigatkalaielakrkitvnci
apglidtgmiemeesalkeamsmipmkrmgqaeevaglasylmsdiagyvtrqvisingg
ml

Timeline for d4iivd_:

• d4iivd_ first appeared in SCOPe 2.03
  
• d4iivd_ appears in SCOPe 2.04
  
• d4iivd_ appears in SCOPe 2.06
  
• d4iivd_ appears in the current release, SCOPe 2.08