SCOPe 2.03: Domain d4iiqb2: 4iiq B:117-244

Lineage for d4iiqb2 (4iiq B:117-244)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries)

8. Domain d4iiqb2: 4iiq B:117-244 [223206]
   Other proteins in same PDB: d4iiqa1, d4iiqb1
   automated match to d1ktke2
   complexed with so4

Details for d4iiqb2

PDB Entry: 4iiq, 2.86 Å

PDB Description: crystal structure of a human mait tcr in complex with bovine mr1

PDB Compounds: (B:) Human Mucosal Associated Invariant T cell receptor beta chain

SCOPe Domain Sequences for d4iiqb2:

Sequence; same for both SEQRES and ATOM records:

>d4iiqb2 b.1.1.2 (B:117-244) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

Timeline for d4iiqb2:

• d4iiqb2 is new in SCOPe 2.03-stable
  
• d4iiqb2 appears in SCOPe 2.04
  
• d4iiqb2 appears in the current release, SCOPe 2.08