Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (195 species) not a true protein |
Species Anaeromyxobacter dehalogenans [TaxId:455488] [226576] (3 PDB entries) |
Domain d4igja1: 4igj A:1-85 [223165] Other proteins in same PDB: d4igja2, d4igja3, d4igjb2, d4igjb3 automated match to d1e6ba2 complexed with so4 |
PDB Entry: 4igj (more details), 1.48 Å
SCOPe Domain Sequences for d4igja1:
Sequence, based on SEQRES records: (download)
>d4igja1 c.47.1.0 (A:1-85) automated matches {Anaeromyxobacter dehalogenans [TaxId: 455488]} mtlrlysywrsssawrvrlglalkglayeyravdllaqeqfqaahqarnpmsqvpvleve edgrthllvqsmailewleerhpep
>d4igja1 c.47.1.0 (A:1-85) automated matches {Anaeromyxobacter dehalogenans [TaxId: 455488]} mtlrlysywrsssawrvrlglalkglayeyravdllaqeqfqvpvleveerthllvqsma ilewleerhpep
Timeline for d4igja1: