Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) consists of one domain of this fold |
Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
Protein automated matches [190396] (26 species) not a true protein |
Species Human immunodeficiency virus type 1 [TaxId:11678] [225971] (15 PDB entries) |
Domain d4ifva2: 4ifv A:430-554 [223150] Other proteins in same PDB: d4ifva1, d4ifvb_ automated match to d1bqna1 protein/DNA complex; protein/RNA complex; complexed with dms, fmq, mg, t27 |
PDB Entry: 4ifv (more details), 2.05 Å
SCOPe Domain Sequences for d4ifva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ifva2 c.55.3.0 (A:430-554) automated matches {Human immunodeficiency virus type 1 [TaxId: 11678]} ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd klvsa
Timeline for d4ifva2: