SCOPe 2.04: Domain d4ieff1: 4ief F:238-579

Lineage for d4ieff1 (4ief F:238-579)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.17: Caspase-like [52128] (1 superfamily)
   3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest

4. Superfamily c.17.1: Caspase-like [52129] (3 families)
   mature protein may be composed of two chains folded in a single domain

5. Family c.17.1.2: Gingipain R (RgpB), N-terminal domain [52137] (2 proteins)
   contains extra N-terminal alpha/beta subdomain
   automatically mapped to Pfam PF01364

6. Protein automated matches [227116] (1 species)
   not a true protein

7. Species Porphyromonas gingivalis [TaxId:242619] [226634] (1 PDB entry)

8. Domain d4ieff1: 4ief F:238-579 [223144]
   Other proteins in same PDB: d4iefb2, d4iefd2, d4ieff2, d4iefh2
   automated match to d1cvra2
   complexed with ba, ca, cl, gol, mg, na, trs

Details for d4ieff1

PDB Entry: 4ief, 2.3 Å

PDB Description: complex of porphyromonas gingivalis rgpb pro- and mature domains

PDB Compounds: (F:) Gingipain R2 Mature Domain

SCOPe Domain Sequences for d4ieff1:

Sequence; same for both SEQRES and ATOM records:

>d4ieff1 c.17.1.2 (F:238-579) automated matches {Porphyromonas gingivalis [TaxId: 242619]}
ngrmivivpkkyeediedfvdwknqrglrtevkvaediaspvtanaiqqfvkqeyekegn
dltyvllvgdhkdipakitpgiksdqvygqivgndhynevfigrfsceskedlktqidrt
ihyernittedkwlgqalciasaeggpsadngesdiqheniianlltqygytkiikcydp
gvtpkniidafnggislanytghgsetawgtshfgtthvkqltnsnqlpfifdvacvngd
flynvpcfaealmraqkdgkptgtvaiiastinqswaspmrgqdemneilcekhpnnikr
tfggvtmngmfamvekykkdgekmldtwtvfgdpsllvrtlv

Timeline for d4ieff1:

• d4ieff1 first appeared in SCOPe 2.03
  
• d4ieff1 appears in SCOPe 2.05
  
• d4ieff1 appears in the current release, SCOPe 2.08