Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (55 species) not a true protein |
Species Porphyromonas gingivalis [TaxId:242619] [226635] (1 PDB entry) |
Domain d4iefb2: 4ief B:580-660 [223141] Other proteins in same PDB: d4iefb1, d4iefb3, d4iefd1, d4iefd3, d4ieff1, d4ieff3, d4iefh1, d4iefh3 automated match to d1cvra1 complexed with ba, ca, cl, gol, mg, na, trs |
PDB Entry: 4ief (more details), 2.3 Å
SCOPe Domain Sequences for d4iefb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iefb2 b.1.18.0 (B:580-660) automated matches {Porphyromonas gingivalis [TaxId: 242619]} ptkmqvtapanisasaqtfevacdyngaiatlsddgdmvgtaivkdgkaiiklnesiade tnltltvvgynkvtvikdvkv
Timeline for d4iefb2: